PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA07g06110
Common Nameorf301
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family NF-YA
Protein Properties Length: 279aa    MW: 30704.3 Da    PI: 10.1782
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA07g06110genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA93.72.2e-29161215358
   CBFB_NFYA   3 plYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                 p+YVNaKQy++IlkRRq Rak ++++kl  k+rkpylheSRh+hA++R RgsgG F
  CA07g06110 161 PIYVNAKQYSAILKRRQVRAKRQAQNKL-VKNRKPYLHESRHRHAMKRVRGSGGHF 215
                 9***************************.*************************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005215.1E-32157218IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115233.474158218IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006167.0E-22161183IPR001289Nuclear transcription factor Y subunit A
PfamPF020451.1E-25161215IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006167.0E-22192215IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005739Cellular Componentmitochondrion
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 279 aa     Download sequence    Send to blast
MSCSSIWNSS DQLEHAPSKK TRVESALKHH SDIKKLESEF QDQDSTSTLS TGQSNHVEAA  60
MGKSKTVLQN LTAHPGWGGI LDVQAESGTK ASLSGKSATN TLPQPQVHHD HPTACLSYPW  120
ADTYFGRLVA TYGSNAIIYP QMVGVTSTRV ALPLECTESL PIYVNAKQYS AILKRRQVRA  180
KRQAQNKLVK NRKPYLHESR HRHAMKRVRG SGGHFLNTKN IQQSKPSSPK HDRNIFNRQA  240
GGNISSYMVQ HSESGSWGTS TQSGTDVTSI FNGDDMFQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A2e-18161219462NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1199208RHRHAMKRVR
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ8654090.0KJ865409.1 Capsicum annuum cultivar CMS line FS4401 mitochondrion, complete genome.
GenBankKJ8654100.0KJ865410.1 Capsicum annuum cultivar Jeju mitochondrion, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016553481.10.0PREDICTED: nuclear transcription factor Y subunit A-3-like, partial
TrEMBLA0A075VW310.0A0A075VW31_CAPAN; Uncharacterized protein
STRINGSolyc08g062210.2.11e-176(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA48002027
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G17590.42e-34nuclear factor Y, subunit A8
Publications ? help Back to Top
  1. Jo YD,Choi Y,Kim DH,Kim BD,Kang BC
    Extensive structural variations between mitochondrial genomes of CMS and normal peppers (Capsicum annuum L.) revealed by complete nucleotide sequencing.
    BMC Genomics, 2014. 15: p. 561
    [PMID:24996600]